PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_20743_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 356aa    MW: 39044.9 Da    PI: 4.5999
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_20743_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.79.5e-172370148
                                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                          rgrWT+eEd++l+++++  G g+W++ ++  g+ R++k+c++rw +yl
  cra_locus_20743_iso_1_len_1094_ver_3 23 RGRWTAEEDQILINYIQANGEGSWRSLPKNAGLLRCGKSCRLRWINYL 70
                                          8*******************************99************97 PP

2Myb_DNA-binding54.33.1e-1776121148
                                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                           rg+ + eE+e+++++++ lG++ W++Ia +++ gRt++++k++w+++l
  cra_locus_20743_iso_1_len_1094_ver_3  76 RGNISSEEEEIIIKLHATLGNR-WSLIAGHLP-GRTDNEIKNYWNSHL 121
                                           7899******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.1E-221473IPR009057Homeodomain-like
PROSITE profilePS5129416.7041870IPR017930Myb domain
SuperFamilySSF466892.28E-2820117IPR009057Homeodomain-like
SMARTSM007171.7E-122272IPR001005SANT/Myb domain
PfamPF002495.9E-152370IPR001005SANT/Myb domain
CDDcd001671.90E-92570No hitNo description
PROSITE profilePS5129425.62771125IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-2574125IPR009057Homeodomain-like
SMARTSM007172.3E-1675123IPR001005SANT/Myb domain
PfamPF002495.4E-1576121IPR001005SANT/Myb domain
CDDcd001672.07E-789121No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009813Biological Processflavonoid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
XTAARLPENM GRAPCCEKVG LKRGRWTAEE DQILINYIQA NGEGSWRSLP KNAGLLRCGK  60
SCRLRWINYL RSDLKRGNIS SEEEEIIIKL HATLGNRWSL IAGHLPGRTD NEIKNYWNSH  120
LSRKLHSYRR PPPPPPPNET SPAATDLPKT TEKSDVAGRA AMKKNKSYNI LKRSVISSIP  180
GTPANVTTKE TLSTGFLQAA EAPAIAAEVI GDTVTSGAGN SYELGLDNGI LNFDDIMDVD  240
GDLATMIFDA DRDAGCGIMS SGDERTTSSE GGGEQGQNCN SPGSNEWENW QLWDDFDNGI  300
GEESGLFSWL WDTTSSPGNN NGEGKFESID DKRDENSVEN EMDSEKQNAM LAWLLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-242112525128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015891841.11e-86PREDICTED: transcription factor MYB12
SwissprotO222645e-78MYB12_ARATH; Transcription factor MYB12
TrEMBLA0A059AX984e-85A0A059AX98_EUCGR; Uncharacterized protein
STRINGVIT_07s0005g01210.t014e-80(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154